PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_015103-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 386aa    MW: 43734 Da    PI: 6.4308
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_015103-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.44.4e-201461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++++G g+W+t ++  g++R++k+c++rw++yl
    NNU_015103-RA 14 KGPWTPEEDKKLIDYIQKHGHGSWRTLPKNAGLHRCGKSCRLRWNNYL 61
                     79*********************************************7 PP

2Myb_DNA-binding52.88.8e-1767110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w++
    NNU_015103-RA  67 RGRFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNT 110
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-27564IPR009057Homeodomain-like
PROSITE profilePS5129426.106965IPR017930Myb domain
SuperFamilySSF466896.74E-3211108IPR009057Homeodomain-like
SMARTSM007171.7E-161363IPR001005SANT/Myb domain
PfamPF002493.6E-181461IPR001005SANT/Myb domain
CDDcd001673.20E-131661No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129419.72966116IPR017930Myb domain
SMARTSM007171.0E-1566114IPR001005SANT/Myb domain
PfamPF002494.1E-1567110IPR001005SANT/Myb domain
CDDcd001671.10E-1169110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MGRAPCCEKN GLKKGPWTPE EDKKLIDYIQ KHGHGSWRTL PKNAGLHRCG KSCRLRWNNY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT RIRKRLLRMG  120
IDPVTHSPRL DLLDLSSILN SPLYNPSQLD LSRLLGIQPL VNPELLRLAT TLLSSQNENR  180
PEFLLQNLHE NQLCNPQLPN DQFASFPPNQ LPTNPIQEIP VCTTSTTPWA PFLDETQLLQ  240
TNVEKFPSNP TSFSCPTSQT NLWQHNEMPC NFQESFVSLP NFSYVGSDHP TADHTLLNNS  300
IFQSNNNSSS SSSHDFGFTS VLSTPSSSTA PLNSSSTNIN SSTEDERDSY CSNVLKFEIP  360
DLLDVNEFML QYQETGAPCF DGKLHY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010268879.10.0PREDICTED: transcription factor MYB39
TrEMBLA0A061GMU41e-157A0A061GMU4_THECC; MYB-like 102
STRINGVIT_00s0203g00070.t011e-156(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.14e-93MYB-like 102